SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPAG_04193.1 from Candida parapsilosis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPAG_04193.1
Domain Number 1 Region: 164-502,546-575
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.09e-57
Family GABA-aminotransferase-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPAG_04193.1
Sequence length 596
Comment | CPAG_04193 | Candida parapsilosis CPAG_04193 (597 aa)
Sequence
MTSPVYATTTTTTTTTTTTTIISSILSSSPSGASSQSWEIIQNTIAQNVLYLLNLLEVLP
GGQIIVRYIKSSYQNDPVRSLFEYCLFIFALTYFFTSKKKENKSEFVKFTPREIDELCDE
WVPETLVEPVTDLEAWKIKAIPEVKGFNGSHIELINPSFKEICHDSSIVNLVKQDFLDLN
SNANIKQVAKTEIQFAGVGACGPPNFYGTQDVHVRLEEDLARYLGTDQAIIYGQDFVTAS
SVLPAYLKRGDLCVVDRNVNLAIQKALIVSRVDLEWYDHNDMEHLEQILTQLKPILDKQK
PLRRRFIITEGLFANTGDLANLPTIVELKNKFKYRLFLDESLSIGVLGNTGKGLTEHYGI
SRDEIAITIGSMANSFASSGGFCVGVEPMIHHQRISSNAYVFSASLPPYSAKVTSQAIKE
INIVEPKTGKSKLMTQLHQRTIFAHDALLSSLKDVPMTITSVPQSPMIHLAFTELYRSQL
NLPLLYGNSIFVTKGKPAKFLNPFDEYLNLESFMLQKIIDYVLKHGKILLTRSKLILEHE
DLPVLPPQLLVNINAGVSEEELQRLAEVLPTAIDEVVSTVTNEDELFELTNELINY
Download sequence
Identical sequences G8BGC6
CPAG_04193.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]