SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56461061|ref|YP_156342.1| from Idiomarina loihiensis L2TR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56461061|ref|YP_156342.1|
Domain Number 1 Region: 548-1036
Classification Level Classification E-value
Superfamily ALDH-like 5.11e-132
Family ALDH-like 0.00000032
Further Details:      
 
Domain Number 2 Region: 189-534
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.29e-107
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000837
Further Details:      
 
Domain Number 3 Region: 18-188
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.57e-61
Family N-terminal domain of bifunctional PutA protein 0.000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56461061|ref|YP_156342.1|
Sequence length 1055
Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Idiomarina loihiensis L2TR]
Sequence
MFKASEVLSKQHQAEDLKSLQQAITDNYIVDEDEYMRELLPLVPADDDTVSAVTERAAKL
VEQVREQADNGVVDAFLQEYSLDTKEGIILMCLAEALLRIPDAYTADALIQDKLSGGDWQ
KHMGQSASWLVNSGTWGLALTNSVTNPTGKAMETPRGAFRRLVRKLGKPIIRKATYTAMQ
IMGKQFVLGRTIEEALKESRDNRDKGYTHAYDMLGEAALTMKDADYYKQQYVNSIKTITK
EEFNNPDAPRPTISIKLSALHPRYEASNHERVLTELATTLTELVKLAKEADVGVTIDAEE
ADRHELSMELFEKVYRSGVCKGWPRFGLVVQAYSKRALPTLCWITALAKECGDEIPVRLV
KGAYWDNEIKWTQENGLLGYPVFTRKSHSDISYLACARYLLSDDTDGAIYPQFATHNAQT
FMAIQQMNETHQRRIEYQRLHGMGDSLYDTIMEQNPGMVVRIYAPVGPHKDLLPYLVRRL
LENGANSSFVHKLLDADTPVNDLVEHPMKTASGYEKYANSKIPLPSEMYGDRTNSLGLNM
NIHSQADDFIAAVQQYRDKQWQGGPIVDGKTIETDHHVSITSPQETSKQVGSIYWGDKKL
SEQALKSANAAYKSWRKVPTDERAECLEKFADLMEANRNELIALCSVEAGKGLQDGIDEV
REAVDFCRYYANQARELMGGPIQLPGPTGEDNELFVEGRGTFICISPWNFPLAIFVGQVA
AALVTGNSVIAKPAEQTGLIAYRAVQLALEAGIPGNVLHFMPGSGAEVGSYLTSQEDIGG
VCFTGSTYTAQAINRALAARTGPIVPLVAETGGQNAMMVDSTALPEQVVTDIVASAFQSA
GQRCSALRVLFVQDDVADRVLDLLRGAMEELQVGDPLLHETDVGPVIDGIAKTNLEQHIS
DIQQAGRLIARAPLPDYAMGGTFVAPTAIEIDSISQLVKENFGPILHVIRFKTSEIDEVI
ESINNTGFGLTFGIHSRNETFAHDVASRIDVGNVYINRNQIGAIVGVQPFGGRGMSGTGP
KAGGPHYLTRFITEKTRSDNITAVGGNATLLSLDD
Download sequence
Identical sequences A0A2D4RCI4 Q5QY28
283942.IL1961 gi|507386391|ref|YP_008035470.1| NYSGRC-FDAO-AAV82793 WP_011235189.1.4909 WP_011235189.1.75220 WP_011235189.1.75540 gi|56461061|ref|YP_156342.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]