SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|433652678|ref|YP_007296532.1| from Prevotella dentalis DSM 3688

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433652678|ref|YP_007296532.1|
Domain Number 1 Region: 18-292
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 7.78e-85
Family Folylpolyglutamate synthetase 0.00000614
Further Details:      
 
Domain Number 2 Region: 301-430
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 3.2e-20
Family Folylpolyglutamate synthetase, C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|433652678|ref|YP_007296532.1|
Sequence length 433
Comment folylpolyglutamate synthase/dihydrofolate synthase [Prevotella dentalis DSM 3688]
Sequence
MNYPETVAYLFSSTLVFEHVGATAYKEGLGNTLALDSHFGHPHHAYPTIHVAGTNGKGSC
SHALAAILQQAGYRVGLYTSPHLVDFRERIRVNGEPISEERVVTFVERERGFFEPLHPSF
FELTTALAFLWFKEQKVDVAVIEVGLGGRLDCTNVITPLLSVITNISLDHTQFLGDTLAK
IAGEKAGIIKHGVPVVVGEAVAETRPVFERAAAGRQAPVVFAQNNPEVTASTAVATGGRD
YQTRSYGPLHGELGGDCQTLNTNTVLTAVSVLRRLEDRTGLHVSAADVRRALPRMASLTG
LMGRWQQLHEAPRVVCDTGHNVGGWQLLAPQIAAQPCRQLRIVFGMVDDKDIDAVMRLLP
RNAVYYWTQAANHRAIPAPRVQALGSAHGLRGRQYPTVAAALRAAMADAAPDDFVFIGGS
SYVVADLLTLNYF
Download sequence
Identical sequences F9D4X9
gi|433652678|ref|YP_007296532.1| WP_005846523.1.10368 WP_005846523.1.41627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]