SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CIMG_03926T0 from Coccidioides immitis RS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CIMG_03926T0
Domain Number 1 Region: 33-123
Classification Level Classification E-value
Superfamily FKBP-like 2.88e-23
Family FKBP immunophilin/proline isomerase 0.0000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CIMG_03926T0
Sequence length 124
Comment | CIMG_03926 | Coccidioides immitis RS peptidyl-prolyl cis-trans isomerase (125 aa)
Sequence
MAPKNKGKGKAKDSSESGDAGGKGKGLKPANSINVRHILCEKHSKKEEALAKLRAGAKFD
EVAREFSEDKARQGGSLGWKIRGSLDAAFEKAAYELEPSTTASPKYAEVKTGFGYHIIMV
EGRK
Download sequence
Identical sequences A0A0J6YHL5 A0A0J8R555 A0A0J8RYM3 J3KCE6
XP_001244485.2.59393 CIHT_07600 CIMG_03926T0 CIRT_07863 CIST_01969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]