SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CIMG_09122T0 from Coccidioides immitis RS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CIMG_09122T0
Domain Number 1 Region: 109-353
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 3.83e-72
Family Glutamine synthetase catalytic domain 0.0055
Further Details:      
 
Domain Number 2 Region: 19-106
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 6.67e-22
Family Glutamine synthetase, N-terminal domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CIMG_09122T0
Sequence length 357
Comment | CIMG_09122 | Coccidioides immitis RS glutamine synthetase (358 aa)
Sequence
MAPKTHISNAENLKKYMELDQRGKIMAEYIWIDACGGVRSKTKTVNKVVKSADELPEWNF
DGSSTGQAPGDNSDVYLRPVAIFPDPFRRGENILVLCETWDSDGSPNKYNYRHEAARLMR
ANAHEHFWFGLEQEYTLLGPDGWPYGWPKGGFPGAQGPYYCGVGTGKVHCRDIVEAHYKA
CLYAGINISGINAEVMPAQWEYQVGPCEGIDLGDQLWMSRFLLNRVAEEFGAIISFAPKP
IPGDWNGAGLHTNVSTEAMRNEGGMKVIEAAMKKLETRHFEHIAVYGEGNEDRLTGRHET
GSIDKFSWGVADRGGSIRIPRQVAKDGKGYFEDRRPASNADPYQITGIIVETLCGAS
Download sequence
Identical sequences A0A0J6FRQ4 A0A0J6YJ81 A0A0J8RSU6 C5PCY5 J3K1N8
CIMG_09122T0 CIRT_08402 XP_001239501.1.59393 XP_003067091.1.1890 CPAT_08093 222929.C5PCY5 CIHT_05642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]