SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CIMG_10075T0 from Coccidioides immitis RS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CIMG_10075T0
Domain Number 1 Region: 137-501
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.47e-92
Family Glutamine synthetase catalytic domain 0.0000556
Further Details:      
 
Domain Number 2 Region: 39-134
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.00000863
Family Glutamine synthetase, N-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CIMG_10075T0
Sequence length 503
Comment | CIMG_10075 | Coccidioides immitis RS glutamine synthetase (504 aa)
Sequence
MPQEGVTALASTGTNMTTDTDLTKVTLDNLEAVLVRDTQVKLAGIDADGILRGKLVSKKK
FLSIAKDGFGFCSVIFGWDMHDQTYFKELAISNKENGYRDMNAIPDLKSFRRIPWENNVP
FFLVNFFDPETHAPISACPRGLLRSATAAMEKLGYKAMAGAEYEFYQFRAPSYGNGTERN
SSGTARFLKTNPVADLPPLTEGMFGYSLTRPVHNQEYYYRIFDTCQAFKCDIESWHTESG
PGVFEAALEFGEIKEIADRAGLFKYVVKSLGSKYGITPVFMAKPVHGLPGNSGHMHVSIV
SNDGKNLFFREQPDLSPPYPDVANLSDLGRHFLAGVLAGLPDIMPLLAPTINSYKRLVEN
FWAPVTVSWGLEHRAASIRLITPPTCSPKGSRLEIRVPGADVNAHYVLAAIVALGWRGVE
KKLEIPVPPLARGENVGNESDKGERLAKSLKEAIAKFMAKDSVAREVFGNEFVDHFGGTR
EHEVRLWEEAVTDWEVKRYIETV
Download sequence
Identical sequences A0A0E1RUF4 A0A0J6YR34 A0A0J8RUS7
CIHT_06347 XP_001239053.2.59393 CIMG_10075T0 CIRT_09603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]