SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000030 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000000030
Domain Number - Region: 1-100
Classification Level Classification E-value
Superfamily DNA clamp 0.00146
Family DNA polymerase processivity factor 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000030   Gene: ENSDORG00000000037   Transcript: ENSDORT00000000037
Sequence length 262
Comment pep:novel scaffold:dipOrd1:scaffold_12413:21716:33465:-1 gene:ENSDORG00000000037 transcript:ENSDORT00000000037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIRMLAKLAKGCILHICPDKLSFILLGSQESGRASLWCELLKENFFSKFQMKGVSAEYNE
IYLQLQLENLTPALNNSHSTEILKIKFINKYSGIFKICIKLLCESNRSCIMTYYFPIEVI
PTHLWNKLQEPIVPNLDVXXXXXXXXXXXXXXXXXXXXXXXXIIEANQNGELNLKMENEL
VSVTTYFQDLGNPPLVPENASEDRQPEEKAEMHINVYQLLHFLGGVQDNPTKATFNMVRN
RISYFEFLFEIYSVKYFIPALN
Download sequence
Identical sequences ENSDORP00000000030 ENSDORP00000000030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]