SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000064 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000064
Domain Number 1 Region: 1232-1324,1408-1631
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 1.11e-19
Family SGL-like 0.048
Further Details:      
 
Domain Number 2 Region: 932-1005
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000271
Family Pre-dockerin domain 0.063
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000064
Domain Number - Region: 773-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00268
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 743-767
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00711
Family EGF-type module 0.093
Further Details:      
 
Domain Number - Region: 1586-1707
Classification Level Classification E-value
Superfamily YWTD domain 0.0353
Family YWTD domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000064   Gene: ENSDORG00000000072   Transcript: ENSDORT00000000075
Sequence length 2766
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3706:78461:273954:1 gene:ENSDORG00000000072 transcript:ENSDORT00000000075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVKDRRHRSLTRGRCGKECRYASSSLDSEDCRVPTQKSYSSSETLKVYDHDSRMHYSNR
VTDLVHRESDEFPRQGSNFTLAELSMCEPSPHRSTYCSDLGILHQGFSLSTGSDADSDTE
GGMSPEHAIRLWGRGLKSRRSSGLSSRENSALTLTDSDNENKSEDENGRPIPPTSSSSLL
PPAQLPSSHNPPPVSCQMPLLDSNTSHQIMDTNPDEEFSPNSYLLRACSGPQQTSGGXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXHFLFKTSSGSTPLFSSSSPGYPLTSGTVYTPPPRLLPRNTFSRK
AFKLKKPSKYCSWKCAALSAIAAALLLAILLAYFIAMHLLGLNWQLQPADAHAFNNGIRT
SLPGSDDAATAASGGKVPWSLKNSSIDSGEAEVGRRATQEVPPGVFWRSQLHLSQPQFLK
FNISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVVESPRERRSIQTLVQNEAVF
VQYLDVGLWHLAFYNDGKDKEMVSFNTVVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXVCSVDCGTHGVCIGGACRCEEGWTGTACDQRVCHPRCIEHGTC
KDGKCECREGWNGEHCTIAKDRXXXXXXGCPDLCNGNGRCTLGQNSWQCVCQMGWRGPGC
NVAMETACADNKDNEGDGLVDCLDPDCCLQSACQSSLLCRGSRDPLEVIQQGQTEWPAVK
SFYDRIKLLAGKDSTHVIPGDNPFHSSLVSVIRGQVLTTDGTPLVGVNVSFIKSLKYGYT
ITRQDGTFDLIANGGAALTLHFERAPFMSQERTVWLPWNSFHAMDTLVMKTEENSIPSCD
LSGFLRPDPIIIASPLSTFFSAAPGHSPIVPETQVLHEELELPGSSVKLRYLSSRTAGYK
SLLKITMTQSAVPLNLVRVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLS
DAVVSVGFEYETCPSLILWEKRTSLLQGFELDPSNLGGWSLDQHHILNVRSGVLHKGTGE
NQFLSQQPAIITSVMGNGRRRSISCPSCNGLAEGNKLLAPVALAVGTDGSLYVGDFNYVR
RIFPSRNVTSILELRXXXXNNPAHKYYLAVDPVSGSLFVSDTNSRRIYRVRSLSGAKDLA
GNSEVVAGTGEQCLPFDEARCGDGGKAVEATLMSPRXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXVRLEWPTDLAVNPMDNSLYLLENNVILRITEN
HQVSVIAGRPMHCQVPGIDYSLSKLAIHSALESASAIAVSHTGVLYITETDEKKINRLRQ
VTTNGEICLLAGAASDCDCKNDVNCVCYAGDDAYATDAILNSPSSLAVAPDGTVYVADLG
NIRIRAVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTMSLVTGEYLYNFTYSPDN
HVTELVDNNGNSLKIRRDSSGSPRHLLMPDNQIVTLTVGTHGGLKAVSTQNLELGLMTYD
GNTGLLTTKSDETGWTTFYDYDHEGRLTNVTRPTGVVTSLHREMEKSITIDIENSNRDDD
VTVVTNLSSVEASYTVVQDQVRNSYQLYNNGTLRVMYANGMGVSFHSEPHVLAGAVTPTI
SRCNISLPTDNGLNSIEWRLRKEQVKGKVTIFGRKLRVHGRNLLSIDYDRNIRTEKVYDD
HRKFTLRIIYDQAGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSEKIDIDKQGRVVS
RMFADGKVWSYSYLDKSMVLLLQSQRQYVFEYDASDRLHAVTMPSVARHSVSTHTSVGYI
RNIYNPPESNASVIFDYSDDGRILKTSFLGTGRQVFYRYGKLSKLSEIVYDSTAVTFGYD
ETTGVLKMVNLQSGGFSCTIRYRKVGPLVDKQIYRFSEEGMINARFDYTYHDNSFRIASI
KPVISETPLPVDLYRYDEISGKVEHFGKFGVIYYDVNQIITTAVMTLSKHFDTHGRIKEV
QYEMFRSLMYWMTVQYDSMGRVVKRELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWR
YSYDLNGNLHLLNPGNSVRLMPLRYDLRDRITRLGDVQYKIDEDGYLCQRGADVFEYNSK
GLLTRAYNKASGWSVQYRYDGVGRRASYKTNLGHHLQYFYSDLYNPTRVTHVYNHSNSEI
TSLYYDLQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGFMMKQLQYTAYGEVYHDSNP
DFQMVIGFHGGLYDPLTKLVHFTQRDYDVLAGRWTSPDYMSGGREPVPFNLYMFKNPLSX
XXXXXXXXXXVKSWLVMFGFQLSNIIPGFPRAKMYFVPPPYELSESQASETGQLITGIQQ
TTERHNQAFMALEGQVISKRLHAGIREKAGHWFATTTPIIGKGVMFAIKEGRVTTGVSSL
ASEDSRKVASVLNNAYYLERMHYSIDGKDTHYFVKIGAADGDLVTLGTTTGRKVLESGVN
VTVSQPTLLVNGRTRRFTNIEFQYCTLLLSIRYGLTPDTLDEEKARVLDQARQRALGTAW
AKEQHRARDGREGSRLWTEGERQQLLSTGRVQGYEGYYVLPVEQYPELADSTNNIQFLRQ
NEMGRR
Download sequence
Identical sequences ENSDORP00000000064 ENSDORP00000000064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]