SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000253 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000253
Domain Number 1 Region: 142-385
Classification Level Classification E-value
Superfamily vWA-like 2.67e-76
Family Integrin A (or I) domain 0.000000594
Further Details:      
 
Domain Number 2 Region: 386-472
Classification Level Classification E-value
Superfamily Integrin domains 1.31e-19
Family Integrin domains 0.0017
Further Details:      
 
Domain Number 3 Region: 44-101
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000942
Family Plexin repeat 0.00097
Further Details:      
 
Domain Number 4 Region: 590-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family Integrin beta EGF-like domains 0.0046
Further Details:      
 
Domain Number 5 Region: 546-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000893
Family Integrin beta EGF-like domains 0.052
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000253
Domain Number - Region: 509-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family Integrin beta EGF-like domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000253   Gene: ENSDORG00000000272   Transcript: ENSDORT00000000272
Sequence length 768
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_2240:5921:86424:1 gene:ENSDORG00000000272 transcript:ENSDORT00000000272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRSALIFLTAAFVCLQTQRGPVSFLRAAWVFSLVLGLNQSEDSRCVSSNAASCARCLAL
GPECGWCVQKDFISGESRSERCDTVSNLIRKGCSADSIENPSVHVIVESENEINTQVTPE
EVSIQLRPGAEANFMLKIHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFS
HDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAV
HRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVV
PNDGNCHLKNNVYIKSTTMEHPSLGQLSAKLIDNNINVIFAVQGKQFHWYKDLLPLLPGT
IAGEIESKAANLNNLVVEAYKKLISEVKVQVENQVHGVLFNVTAICPDGARKPGAVGCGN
VTSNDEVLFNVTVTMKNCEVTGGKSFAILKPIGFNETTKIHIHRSCRCQCEESGRPERQC
VDEAFQDPKCLHCDESKCHLSEHRLPSESCQSHKDQPVCSGRGVCVCGKCLCHKIKLGKV
YGEFCEKDDFSCPYHHGSLCAGHGECEAGRCQCFGGWEGDRCQCPSASAQQCVNSQGQVC
SGRGTCVCGKCECTDPRSIGRFCEHCPTCPTACSDNWNCLQCLHPHNLSQVLRAQCKTSC
ALAEQQLYADQIPECLSTPSYLRIFFIIFIVTFLIGLLKVLIVRQVILQWNSNKIKSSSD
YRASTSKKDKLLLQSVCTRTVTYRREKPEEIKLDISKLNAHETFRCNF
Download sequence
Identical sequences ENSDORP00000000253 ENSDORP00000000253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]