SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000413 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000413
Domain Number 1 Region: 2-379
Classification Level Classification E-value
Superfamily ALDH-like 1.57e-138
Family ALDH-like 0.000000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000413   Gene: ENSDORG00000000437   Transcript: ENSDORT00000000437
Sequence length 452
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5976:5040:23807:1 gene:ENSDORG00000000437 transcript:ENSDORT00000000437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFINNDWHESKSGKKFATYNPSTLTKICDVEEGDKPDVDKAVEAAQAAFQRGSPWRRLDG
LSRGRLLHQLADLVERDRAILATLETMDTGKPFLHAFFIDLEGCIKTLRYFAGWADKIQG
RSIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLVWKLAPALSCGNTAVLKPAEQTPLTA
LYLASLIKEVGFPPGVVNIVPGFGPTVGAAISSHPQINKLAFTGSTEVGKLVKEAASRSN
LKRVTLELGGKNPCIVCADADLDLAVECAHRGAFFNQGQCCTAASRVFVEEQIYPEFVRR
SVEYAKKRSVGDPFDVSTEQGPQIDQEQFDKILELIESGKREGAKLECGGAALQDSGLFI
TPTVFSEVTDNMRLAREEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXVNCYNALYAQAPFGGFKLSGN
Download sequence
Identical sequences ENSDORP00000000413 ENSDORP00000000413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]