SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000501 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000501
Domain Number 1 Region: 10-54
Classification Level Classification E-value
Superfamily LysM domain 0.00000000445
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000501   Gene: ENSDORG00000000538   Transcript: ENSDORT00000000537
Sequence length 786
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4811:14125:66506:1 gene:ENSDORG00000000538 transcript:ENSDORT00000000537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFQKPKGTIEYTVESRDSLNSIALKYDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVS
SVESSPSLSPISPLSPTSSEAEFDKTTNPDVVFPKEATPSSTVTGIRPSRVVSSTSEEEE
AFTEKFLKINCKYITSGKGTVSGVLLVTPNNIMFDPHKSDPLVQENGCEDYGIMCPMEEV
MSAAMYKEILDSKIKESLPVEIDQLSGKDFCHSKKMAGMNTEETDSRIRDAGNDSASTAP
RSTEESLSEDVFTESELSPIREELISSDELRQDKSSGASSESVQTVNQTEGECLRAKSVS
TSTPGHLKSKVGYSTNEVGALCHDTDLSNLEMTTKEDEDTDNIQEASDRKEQRTSIKDHA
GRDSFHPENSLHREEGGKENIICGETTEFNQKQTVNKGKQGKEQKQDSETEVEELRKLWK
THSMQQTKQQRENIQQVSQKEVKHKIASADGHVDGSSLLKEKRRHRLHKFLCLRVGKPMR
KTFVSHASATMQQYAQRDKKHEYWFAVPQERTDHLYAFFIQWSPEIYAEDTGEYTREPGF
IVVKKMEESETNEDSTSQATAREWEVVSVAEYHRRIDALNTEELRTLCRRLQITTREDIN
SKQVAPIKADLESESFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTS
LKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVFK
WTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNRTLSKKEDFFIQDI
EIWAFE
Download sequence
Identical sequences A0A1S3EWY5
ENSDORP00000000501 ENSDORP00000000501 XP_012867938.1.60039 XP_012867939.1.60039 XP_012867942.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]