SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000521 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000521
Domain Number 1 Region: 285-546
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.33e-76
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 170-278
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-32
Family Kringle modules 0.00031
Further Details:      
 
Domain Number 3 Region: 70-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000738
Family EGF-type module 0.017
Further Details:      
 
Domain Number 4 Region: 109-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000356
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000521   Gene: ENSDORG00000000557   Transcript: ENSDORT00000000559
Sequence length 551
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3856:71309:96521:1 gene:ENSDORG00000000557 transcript:ENSDORT00000000559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAKVSELLLLLIVLVGKPANGFSLMPYLEHLDPDWTPDYYYDSFEQSNPEEASTTSPTP
ENPGWYYADDDPCQPNPCKHGGDCVISGDTFTCTCPAPFSGNRCQNVQNKCKNNPCGRGE
CLMTRTSPYYRCACKHPYTGPDCSKVLSVCRPNPCLNGGTCTRHKRRSRFSCSCPDQFRG
RFCEIGPDDCYVGDGYSYRGKVSRTVNQNPCLYWNSHLLLQENYNVFMEEAEAHGIGEHN
FCRNPDRDQKPWCFIKVNSEKVKWEYCDISACSAAPEESPMEPSIKQPEFDSCGRTETAE
PVKRIYGGFKSTAGKHPWQASLQTSMPLTTPMPQGHFCGGALIHPCWVLTAAHCTEIKTR
HLKVVLGDQDLKKTEFHEQSFQVEKILKYSQYNEEDEIPHNDIALLKLKPVDGHCALESK
YVKTICLPEAPFPSGTECHISGWGVTETGDGSRQLLDAKVKLIANKLCNSRQLYDHMIDD
SMICAGNLQKPGPDTCQGDSGGPLTCEKDGIYYVYGIVSWGQECGKKPGVYTQVTKFLNW
IKVTIQREAGF
Download sequence
Identical sequences ENSDORP00000000521 ENSDORP00000000521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]