SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000550 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000550
Domain Number 1 Region: 148-219,266-522
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.16e-92
Family NadC C-terminal domain-like 0.0000247
Further Details:      
 
Domain Number 2 Region: 15-147
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 2.75e-36
Family NadC N-terminal domain-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000550   Gene: ENSDORG00000000591   Transcript: ENSDORT00000000591
Sequence length 565
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1373:18288:21517:-1 gene:ENSDORG00000000591 transcript:ENSDORT00000000591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAENPAEAGAAARPLLTDLYQATMALGYWRAGRARDHAEFELFFRRCPFGGAFALAAGL
RDCLRFLRTFCLRDADVQFLASVLPPDTDPAFFEHLRTLDCSGVTLRALPEGSLAFPGVP
LLQVSGPLLLVQLLETPLLCLVSYASLVATNAARLRLIAGPNKRLMEFGLRRAQGPDGGL
TASTYSYLGGFDSSSNTLAGQLRGVPVAGTLAHSFITSFLGSEVPPDPMLAPAIGTGPRV
DLTTSVKVWLERVCAHLGLGMQEPHPGERAAFVAYALAFPRAFQGLLDSYSVQRSGLPNF
LGVALALGELGYRAVGVRLDSGDLLQQAQEIRAVFRTTATRFQVPWLEFIPITVSNNIDE
EELARLAQEGTEVNAFGIGTSLVTCPRQPSLGCVYKLVSVGGQPRMKLTEEPEKQTLPGS
KAAFRLLDSAGFLLLDVLQLAEEPPPQAEKELKVWPLGARDPCTVKPARVEPLLRRWLHK
GQLCEPLPSLAESRAFAQWSLNRLSPAHKQLQSPAPYQVGEDQPGPCARRARVPGVPTNP
SLSLQVALSEQLRALVDRLSARGAP
Download sequence
Identical sequences ENSDORP00000000550 ENSDORP00000000550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]