SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000696 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000696
Domain Number 1 Region: 402-574,603-664
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.36e-39
Family Voltage-gated potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 668-798
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.71e-29
Family cAMP-binding domain 0.0014
Further Details:      
 
Domain Number 3 Region: 37-126
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.71e-21
Family Flavin-binding PAS domain 0.00000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000696   Gene: ENSDORG00000000745   Transcript: ENSDORT00000000745
Sequence length 1157
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_338:405607:492692:-1 gene:ENSDORG00000000745 transcript:ENSDORT00000000745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVPKGHVAPQNTLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQ
RPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGA
VIMFILNFEVVMEKDMVGSPAHDTNHRGPPISWLAPGRAKTFRLKLPALLALTARESSVR
PGGTGSTGAPGAVVVDVDLSPAAPSSESLALDEVSAMDNHVAGMGPAEERRALVGPSSPP
ASARGPHPSPRAHGLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGGLPPPPR
HASTGTMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREIIAP
KIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLXXXX
XXXXXXXXXXXXXXXXXXXXXXDCGYACQPLAVVDLIVDIMFIVDILINFRTTYVNANEE
VVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKLDR
YSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGDQIGKPYNSSG
LGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVSA
IIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFP
ECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALYF
ISRGSIEILRGDVVVAILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXTNMIPGSPGSAELEGGFNRQRKRKLSFRRRADKDTEQ
PGEVSALGSGRAGAGLSGRGRPGGPWGEGPSSGPSSSESSEDEGPGHSSSSLRLVLFSSS
RPSAEPPGGELLTDCDKSSHTCNSLSAISGVSNIFXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSMTLVPPAYSAVT
TPGPGPAPTSPLLPVGAIPTLTLDSLSQVSQFMAFEELPPGAPELPQDGPTRRLSLPGQL
GALTSQPLHRHGSDPGS
Download sequence
Identical sequences ENSDORP00000000696 ENSDORP00000000696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]