SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000807 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000807
Domain Number 1 Region: 312-401
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.34e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 141-192
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000121
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.025
Further Details:      
 
Domain Number 3 Region: 36-95
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000694
Family HLH, helix-loop-helix DNA-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000807   Gene: ENSDORG00000000860   Transcript: ENSDORT00000000859
Sequence length 787
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3957:156334:669509:1 gene:ENSDORG00000000860 transcript:ENSDORT00000000859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITAQHPLPNQSECRKIYRYDGIYCESTYQNLQALRKEKSRDAARSRRGKENFEFYELAKL
LPLPAAITSQLDKASIIRLTISYLKMRDFANQGDPPWNLRMEGPPPNTSVKVIGAQRRRS
PSALAIEVFEAHLGSHILQSLDGFVFALNQEGKFYISETVSIYLGLSQVELTGSSVFDYV
HPGDHVEMAEQLGMKLPPGRGLLSQGTAEDGASSASSSSQSETPEPVESTSLLTTDNTLE
RSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLSHGRTVPSQIMGLVVVAHALPP
PTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVDIVGKRCYHFIHAEDVEGIRH
SHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKNANEKNIIWVNYLLSNPEYKD
TPMDIAQLPHLPEKTSESSETSDSESDSKDTSGITEDNENSKSDEKGNQSENSEDPEPDR
KKSGNACDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFENPKAAEDGFGGLGPMQIKVERY
VESESDLRLQNCESLTSDSAKDSDSAGEAGAQASSKHQKRKKRRKRQKGGSASRRRLSSA
SSPGGGGGGLEAGLVEPPRLLSSPHSASVLKIKTEISEPINFDNDSSIWNYPPNREISRN
ESPYSMTKPPSSEHFPSPPGGGGGGGGGGGGAGLHVAIPDSVLTPPGADGGGAATRKTQF
STSASTALAPVVAAAAASDPLSPPLSASPRDKHPPGGGGSGGSNGGGGPGASNSLLYTGD
LEALQRL
Download sequence
Identical sequences ENSDORP00000000807 ENSDORP00000000807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]