SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000934 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000934
Domain Number 1 Region: 292-549
Classification Level Classification E-value
Superfamily ALDH-like 2.49e-67
Family ALDH-like 0.000017
Further Details:      
 
Domain Number 2 Region: 33-217
Classification Level Classification E-value
Superfamily ALDH-like 2.75e-24
Family ALDH-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000934   Gene: ENSDORG00000000994   Transcript: ENSDORT00000000995
Sequence length 565
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5726:32521:63308:-1 gene:ENSDORG00000000994 transcript:ENSDORT00000000995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPPRPFLLRCSRLAGAWTGVGLRWKHASPLKVANEPILAFTPGSPERDALQKALKDLK
GHTEAIPCVVGDEEVWTSDIRYQVSPFNHRHKVAKFCYADKALLNKAIQAALAARKEWDL
KPLADRAQIFLKAADLLSGPRRAEVLAKTMLGQAKTVIQAEIDAAAELIDFFRFNAKFAM
ELEGEQPISTPPSTNSMVYRGLEGFVTAISPFNFTAIGXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFKHLWKQV
AQNLDRFHTFPRLAGECGGKNFHLVHRSADVDSVVSATLRSAFEYGGQKCSACSRLYVPA
SLWPQIKGRLLEELRGIKVGDPAEDFGTFFSAVIDAKSFARIKKWLAHARSSPNLTVLAG
GACNDSVGYFVEPCVVESKDPQDPIMKEEIFGPVLTVYVYPDDKFRETLQLVDSTTSYGL
TGAVFAQDKDVVQEARTVLRNAAGNFYVNDKSTGAVVGQQPFGGSRASGTNDKPGGPHYL
LRWTSPQVIKETHEPLGDWRYSYMQ
Download sequence
Identical sequences ENSDORP00000000934 ENSDORP00000000934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]