SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001012 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001012
Domain Number 1 Region: 111-364
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 9.94e-48
Family ADP-ribosylglycohydrolase 0.00048
Further Details:      
 
Domain Number 2 Region: 25-67
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 0.0000575
Family ADP-ribosylglycohydrolase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001012   Gene: ENSDORG00000001078   Transcript: ENSDORT00000001077
Sequence length 368
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_958:32877:37172:1 gene:ENSDORG00000001078 transcript:ENSDORT00000001077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAAAAMTATGGGGAGAARSLSRFRGCLAGALLGDCVGAVYEAHDTVSLTSVLSHV
QSLEPDPGTPGSARTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQEYKDPDRGY
GAGVITVFKKLLSHKCHDVYEPARAQFNGKGSYGNGGAMRVAGIPLAYSSIKDVQKFARL
SAQLTHASSLGYNGAILQALAVHLALQGESSSGRFLEQLLGHMEELEGDPQSVLAARELG
MEERPYSSRLKKIGELLDQDSVSREEVVSELGNGIAAFESVPTAIYCFLRCMDPDPEIPT
AFNSLQRTLIYSISLGGDTDTIATMAGAIAGAYYGMDQVPESWQQSCEGYEETDVLAQSL
HRVFQKSL
Download sequence
Identical sequences ENSDORP00000001012 ENSDORP00000001012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]