SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001065 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001065
Domain Number 1 Region: 405-437,475-588
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.09e-26
Family Phosphate binding protein-like 0.00027
Further Details:      
 
Domain Number 2 Region: 740-811
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000000196
Family Phosphate binding protein-like 0.0021
Further Details:      
 
Domain Number 3 Region: 293-391
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000416
Family L-arabinose binding protein-like 0.011
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001065
Domain Number - Region: 571-669
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00288
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001065   Gene: ENSDORG00000001134   Transcript: ENSDORT00000001135
Sequence length 1041
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2005:62097:81035:1 gene:ENSDORG00000001134 transcript:ENSDORT00000001135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFVRALWLGLALAVALGWGAARGHPQPCGALARLGGSVRLGALLPRAPAARARVRALAR
ASLAPPLPHNLSVELVAAPPARELASFAHRMFLKLVPPGVATLLASPEARPELRQLQSLA
AATETPVLSVLRREARAPLGAPTPFHLQLDWASPLETLLDVLVSLLHAHAWENIGLVHCR
VRDPSSLVALWTSRAGQAPKLVLDLSRPDTEDTALHTRLAPLGTLAGEEAPVSAAVLLGC
DTARIGRVLEAAPPGPRWLLGTPLPAEALPTTGLPPGVLALGEVTRPPLEDAIHDALELM
TQALSSAAHVQPERALLPTTVNCEELPRAGPESAGSFLARFLANTSFQGRTGPVWVTSSS
QVHITRSFKVWSLRRDPWGDPAWATVGSWRDGQLVLEPGTAGVRPPSPPGAQTRPKLRVV
TLVEHPFVFVREPDEDGQCPAGQLCLDPSTNDSATLDALFAALANGSVPWALRKCCYGYC
IDLLERLAEDTPFDXELYIVGDGKYGALRDGLWTGLVGDLLAGRAHMAVTSFSINSARSQ
VVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSP
YGLTPRGRNRDTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSY
TANLAAVMVGDKTFEELSGIHDPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQN
SPLTSNLSEFISRYKSSGFIDLLHDKWYKMVPCGKRAFAVTETLQMGIYHFSGLFVLLCL
GLGSALLSSLGEHVFYRLALPRIRRGNRLQYWLHTSQKIHRALNTGPPEGPQERLEPEPS
GAEEPRLDPKAPRWKRVRRAVGKERRVRFLLEPGAAAAPDSEAGEADARDREACVEPLPP
GGPVWLCSNGRPAAPRTAELEALARHIEDVKERLRQALLRRGELRAQLGSGVRHRPLRLL
QAAAQMTTRTLPPTCQPSRQW
Download sequence
Identical sequences ENSDORP00000001065 ENSDORP00000001065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]