SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001157 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001157
Domain Number 1 Region: 10-238
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.44e-74
Family Carbonic anhydrase 0.0000000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001157   Gene: ENSDORG00000001236   Transcript: ENSDORT00000001236
Sequence length 259
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5166:15054:27027:1 gene:ENSDORG00000001236 transcript:ENSDORT00000001236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPLWENLDLVISDRQSPINIRWRDSVFDPDLKPLTISYDPHTCLHIWNNGYSFLVEFEDS
TDKSVMRRLHYREHFFHWGADDWSEHTVDSKCYPAELHLVHWNAVKFKSFEDAALEENGL
AVIGVFLKLGKHHKELQKLVDTLPSKHKDTLTEFGSFDPSCLMPTCPDYWTYSGSLTTPP
LSESVIWIIKKQPVEVDHNQLEQFRTLLITSKGEKEKRMVDNFRPLQPLMNRTVRSSFRH
DYVLNVQAKPKPAASQVAP
Download sequence
Identical sequences ENSDORP00000001157 ENSDORP00000001157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]