SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001190 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001190
Domain Number 1 Region: 136-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 2 Region: 106-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000197
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001190   Gene: ENSDORG00000001272   Transcript: ENSDORT00000001271
Sequence length 272
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5414:6295:9393:1 gene:ENSDORG00000001272 transcript:ENSDORT00000001271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSRELPLLWFLVLAAGGTEHVYGPGRRVCAVEVQGPASESFVQRVYQPFLTTCAGHRA
CSTYRTIYRTAYRRSPGLAPAGPRYACCPGWKRTGGLPGACEAAICQPPCRNGGHCAQPG
RCRCPAGWKGDTCQTDVDECSTGGAGCPQRCVNTAGSYSCQCWEGQSLSADGTLCLPKGG
ASRMAPDPTGADAVVQEEVRRLQSRVDALEQKLQLALAPLHSLASRASEHGFQDPGSLLA
HSLQQLDRVDSLSEQVSFLEEQLGSCSCRKDL
Download sequence
Identical sequences ENSDORP00000001190 ENSDORP00000001190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]