SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001373 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001373
Domain Number 1 Region: 2-430
Classification Level Classification E-value
Superfamily ALDH-like 1.09e-126
Family ALDH-like 0.000000000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001373   Gene: ENSDORG00000001469   Transcript: ENSDORT00000001470
Sequence length 507
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_558:7329:31853:1 gene:ENSDORG00000001469 transcript:ENSDORT00000001470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERHVLRLRQAFRAGRPRPLRFRMQQLEALRKMVQEHEKDILAAISADLCKSEFNAYSQE
VISILGEIDFVLENLAEWVTAKPVKKNLLTMMDEAYIQPEPLGVVLIIGAWNYPFLLTIQ
PLVGAIAAGNAVIIKPSELSENTAEILAKLLPQYLDQDLYAVINGGVVETTELLKQRFDH
ILYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCNLDIACRRITWGKFMNCGQT
CIAPDYILCESALQHQIVQKIKETLKEFYGENIKESSDYERIINIRHFQRIRRLLEGQKI
AFGGEIDEATRYIAPTILTDVDPETKVMQEEIFGPILPIVPVKNADEAIHFINEREKPLA
LYVFSHNNKLIKRMIDETSSGGVTGNDVIMHFTLNSLPFGGVGSSGMGAYHGKHTFDTFS
HQRPCLLKSLKRESANKLRYPPNSQSKVDWAKFFLLKQFNKGKIGLLLLTFLGVMTAVLA
KKYQAVLRRKALLICLVVYRLRWPNEQ
Download sequence
Identical sequences A0A1S3F6X3
ENSDORP00000001373 XP_012872000.1.60039 ENSDORP00000001373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]