SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001383 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001383
Domain Number 1 Region: 302-507
Classification Level Classification E-value
Superfamily ALDH-like 5.37e-62
Family ALDH-like 0.00000000768
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001383   Gene: ENSDORG00000001480   Transcript: ENSDORT00000001482
Sequence length 525
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_558:68025:73637:-1 gene:ENSDORG00000001480 transcript:ENSDORT00000001482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPWRLVRPSRMKPTSTRSPWVWFSSSVPGTTPSTSPSSPWWAPLLQRGRGLFWDGLEPV
GDESDACKTKPFSVSKCPRRQDQVFTGLALSLYVGKSHSQPIRIKGASTALGKPRPESLS
LSLSLCLSVSFHIFFPPFKCSTEQHVPVCTWACSVCTCAYXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXRIAWGKFMNSGQTCVAPDYILCDPSIQNQIVEKLKKSLREFYGENAKQSRDYGRIVSD
RHFQRVISLIEGQKVAHGGTWDAASRYIAPTILIDVDPQSPVMQEEIFGPVMPIVCVRSL
EEAIQFINQREKPLALYVFSNNDKVIKKMIAETSSGGVTANDVIVHITVHSLPFGGVGYS
GMGAYHGKKSFETFSHRRSCLVRSLRNDEVHKARYPPSPAKMPRH
Download sequence
Identical sequences ENSDORP00000001383 ENSDORP00000001383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]