SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001455 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001455
Domain Number 1 Region: 455-560,682-786
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.38e-52
Family Phosphate binding protein-like 0.0000000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001455   Gene: ENSDORG00000001560   Transcript: ENSDORT00000001558
Sequence length 1459
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3912:12503:56238:-1 gene:ENSDORG00000001560 transcript:ENSDORT00000001558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKARTECCSPKFWLVLAVLAVSGSRARSQKSSPSIGIAVILVGTSDEVAIKDAHEKDDFH
HLSVVPRVELVAMNETDPKSIITRICDLMSDRKVQGVVFADDTDQEAIAQILDFISAQTL
TPILGIHGGSSMIMADKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLINVTFEGRNLSFSEDGYQMHP
KLVIILLNKERKWERVGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVE
SVDPLSGTCMRNTVPCQKRIISENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYL
VTNGKHGKKINGTWNGMIGGVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSR
SNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGRXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLS
LKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQIDLAI
LQLFGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXRHCFMGVCSGKPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILR
LLRTAKNMANLSGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNPPCEENLFSD
YISEVERTFGNLQLKDSNVYQDHYHHHHRPHSIGSTSSIDGLYDCDNPPFTTQPRPLGKK
PLDLGPPPAKHGQLGDLYGKFSFKSDRYGHDDLIRSDASDISTHTVTYGNIEGNAAKRRK
QQYKDSLKKRPASAKSRREFDEIELAYRRRPPRSPDHKRYFRDKEGLRDFYLDQFRPKES
SPHWEHVDLTDIYKERSGDGFKRDSVSTGGGGSCPNRPHVKHPTGDKHVVGGVPAPWEKS
LSSVDWDERSTGNFCRSCPSKLHNYATAVVPGQSSGRQPCIRCEACKKAGNLYDISEDNS
LQDLEPGPTPVPAGAAPSTKYPQSPTNAKAQKKNRNRLRRQHSYDTFVDLQKEEAALAPR
SVSLKDKSRFLDGSPYAHMFEMAAGEGGFANSKASVPTAGHHHNPGGGGYMLSKSLYPDR
VTQNPFIPTFGDDQCLLHGSKSHFFRQPTVAGAAAKARPDFRGLVAGKPGVAAGHFQKDM
CIGNQSNPCVPKNKNPRAF
Download sequence
Identical sequences ENSDORP00000001455 ENSDORP00000001455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]