SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001470 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001470
Domain Number 1 Region: 332-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000781
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 2 Region: 821-869
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000502
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 3 Region: 974-1025
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000725
Family Laminin-type module 0.0031
Further Details:      
 
Domain Number 4 Region: 867-917
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000204
Family Laminin-type module 0.0083
Further Details:      
 
Domain Number 5 Region: 265-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000265
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 6 Region: 1084-1134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 7 Region: 927-976
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 8 Region: 510-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000271
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 9 Region: 773-823
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number 10 Region: 1132-1179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000921
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 11 Region: 1026-1081
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000446
Family Laminin-type module 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001470
Domain Number - Region: 87-159
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000952
Family beta-mannanase CBM 0.09
Further Details:      
 
Domain Number - Region: 1568-1755
Classification Level Classification E-value
Superfamily Tropomyosin 0.00111
Family Tropomyosin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001470   Gene: ENSDORG00000001572   Transcript: ENSDORT00000001573
Sequence length 1761
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_925:135015:232709:-1 gene:ENSDORG00000001572 transcript:ENSDORT00000001573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFQLSLFLHLGWLSGWKAEDECGRGACRPSPGNLLVGRSAQLTASSTCGLKEAQKYCIL
SYLEGEHKCFICDSRLPYNPHTQPNSHTIENVIPSFEPHREKTWWQSENGLDHVSIRLDL
ETLFQFSHLILTFKTFRPAAMLVERSTNYGHTWKVLKYFAKDCAISFPGITAGQAQKVGD
LVCDSRYSDVEPSTGGEVVLKVLDPSFEIENPYSPQIQDLVTLTNLRINFTKLHTLGDTL
LGRQQNDSLDKYYYALYEMIVRGSCFCNGHANKCEPLQQVQGDIFSSTAVVHGHCVCQHN
TDGPNCERCKDFFQDAPWRPAVGAQDSACRACSCNGHSERCHFDMTAYLASGGLSGGVCE
DCQHHTEGQHCERCRPLFYRDPFKAISDPYACLREFLXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXCKPSYFGLSASDPLGCRXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXAGSWGPGDHLHGCAPCDCAIGGAYSNTCSPKDGQCDCRPHVTGRRC
TEPAPGYFFAPLNFYLYEAEEASPLQGLAPLVTFGQVSAVHIVLGELEPGSPVTWTGPGF
ARVLPGAGLRFAVNNIPFPMDFTIVVRYETQVLFNSNSVMXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXLALLPTPICLGPDVQYSIDLYFSQPLEGESHAHSYIQVDSLGLVPHVNS
LEDFCSKQDMEEYQMHGCAEMAWEVEARVLPEACERLVVMXXXXXXXXXXXXCKCHPQGA
VGTNCSRLGGQCQCKPLVAGRCCDRCSTGSYSLGHHGCHPCHCHPEGSKSTVCDQVTGQC
ACHGEVTGRRCDRCLDGYFGFPSCHPCSCHGFAELCDPDTGSCFNCGGFTTGKHCERCID
GYYGNPTSGQSCRPCLCPDGPSSDQYFAQSCSQSPWTSDITCNCLQGYSGTQCEECAPGF
FGNPRVSGEPCRPCACNNNIDVTDPESCSRVTGECLRCLHNTWGPHCQLCQPGHFGSALN
QTCKRCSCHPSGVNPLACPPDAGVCLCDPVTGVCPCLPHVTGLACDSCADGYWNLVPGRG
CQPCNCDPQGSQSSRCDQLTGQCPCKLGHGGKRCSECKENYYSDPSRQCIPCKCNSEGSR
MPLCDPDTGMCHCREGVSGQQCDRCARGHNQEFPACLPCHFCFDQWDHTISSLSKAVQGL
IANMEDKRETLTGCEVDFQNLRENVSAIKRLLKQPLHSPGEFLNVKDYYDSVRKQFMQLS
EQLKTVYEFKDLKETIERMENETDILLENLQEEVDLQSSILNANIIDSSENITKYYHISE
SAEKKTNETSSIINNSENTRNNLRTILDTVTSKEDLLLKKLEQIKVPDIQKLNEKVCGEQ
GSLPCNLSSCGGSVCTGPEGLQQCDGPGCQGLLTLSRNILQKAQEAEAVIHHXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENVPPEDI
EKVANRVLNIHLPITSQNLTHELDEIQTFVQLCEDYKIDVNRLNKAADGAQQLLVKATAA
EKAADGLLNLDKTLNKMQQAQITQRQTNTSITQLTVEITKIKKNVLQAENQAKEIKNKLN
FTKQQLELEDELTLLQTKWQRSQDLMGRAKSQADSALHQAGRAEKEFVELENQYAILQHE
TRARGLTMETWGKVIQLKEAAVKLAETEDKITRIAELEKKIQDLNLSRQEKADQLKQLED
QVVAIKNEIVEREKKYAICYN
Download sequence
Identical sequences ENSDORP00000001470 ENSDORP00000001470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]