SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001612 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000001612
Domain Number - Region: 35-155
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 0.0232
Family beta-CASP RNA-metabolising hydrolases 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001612   Gene: ENSDORG00000001726   Transcript: ENSDORT00000001725
Sequence length 223
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4824:36586:38611:-1 gene:ENSDORG00000001726 transcript:ENSDORT00000001725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQWAVGRRWAWAALFLAAAAVLTQVLWLWLGTQTFVFQPEEIAQLARQYAGLDQELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSSGHSGRY
WAEISDTIISGTFYQWREGTTKSEVFYPGETVVHRPGEATAVEWAPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFFTLFYTLRSYARGLRLELTTYLFGQDP
Download sequence
Identical sequences A0A1S3G0H5
ENSDORP00000001612 ENSDORP00000001612 XP_012882145.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]