SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001669 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001669
Domain Number 1 Region: 431-515
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000747
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 2 Region: 42-87
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000119
Family Elafin-like 0.0013
Further Details:      
 
Domain Number 3 Region: 619-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000967
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001669
Domain Number - Region: 520-614
Classification Level Classification E-value
Superfamily SEA domain 0.00107
Family SEA domain 0.018
Further Details:      
 
Domain Number - Region: 186-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0758
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001669   Gene: ENSDORG00000001772   Transcript: ENSDORT00000001782
Sequence length 1046
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_5963:7696:35767:1 gene:ENSDORG00000001772 transcript:ENSDORT00000001782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVYQTQYLATEVPESKNVTDCCEGHEQLGLYCVLPLNRSREFASRPGSCPASEPELPTPR
RCSWDTDCPGLQKCCPWPAGHRCTAPVPRAAKRSLVSWYNITVLVKMDFEDLQQVDPGFR
NHTRLLYSVTSALQPLNPAVHYLHSAGGDTFTTVSWLLLGLTRLLPVANVSAMLDDMVKR
VYEVINIQVQDVNECLYDELHTCSEAELCQNMEGSHLCVRAQESSTSSPQRPNHTDSGDV
VNSTGSGLSAVAGVTVPALDSGTAVPSPESLTLSPSPWTPQGTPATSQAQTPGPPSRRGA
GDLGSHDRNSTGPGAEEEAPSTAPSWETGPGSTGGSTCRRGSSPPRGSPHGTKPSTPESP
GQLLGNTTTEPPSPPTTKDASGHVVWHTGLPPRETPVNAATLQTKEPEPAPGPGLPSAPT
PVPLQHPACGPGSITRVTVSNVSSTGFHLQWAADPAPLPTFHLSLVPARGPAVSVDTQNT
SVALSGLEPGVLHLVQITARACGKEGTRTDLKVRTAAQKLRGKVRIANVRYSEALGNTSS
QEHRDFLGRFLSTVREPLPAMLRQHMDAGGIRLNVTSITNGSVVVDFTLLVIADVDIREV
SAAFLSALHNASRLEVVRGDPFIQDFDECASMEHDCVPGTACHNTLGSFVCSCAGGASNF
HVEFSGRPCEGASPGNASQAPGPEQPLPPAGTRAGAVPGASSAAQGRAPRLTLTEAVDVS
CEVEKVALAVQRRFLQQESIPAASLYLGQPSCNASSSNGSHVFLVAGWGECGTLVQSNMT
DTVVRTTLRNDLSPEGVLHHPKILSPILCAFRNNLLASSGYAPQWGVYTIVEDLHGAGNF
VTEMQVFIGDSPIPQNYSVSASDDVKIEVGLYRQKSNLRVVLMECWATPSSNARDPVTFG
FINNSCPIPNTYTSVIQNGDSSKAQFKLRIFSFVNNSIVYLHCKLRVCLENPGATCKISC
RNFRSVSNSEDSEFFQMSWGPLMRSERRPPCVKPGPGAGLILLIVGAVLVVVGAAAAFLI
TRYQRMTGNYNLKAQAGNFGYQVFYE
Download sequence
Identical sequences ENSDORP00000001669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]