SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001851 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001851
Domain Number 1 Region: 4-80,184-413
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.53e-45
Family WD40-repeat 0.0061
Further Details:      
 
Domain Number 2 Region: 1507-1581,1633-1778,1836-1904
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.98e-39
Family WD40-repeat 0.0067
Further Details:      
 
Domain Number 3 Region: 619-713,814-872,970-1087,1159-1199
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.04e-37
Family WD40-repeat 0.0096
Further Details:      
 
Domain Number 4 Region: 1316-1588
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.49e-24
Family WD40-repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 385-529
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000279
Family Quinoprotein alcohol dehydrogenase-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001851   Gene: ENSDORG00000001958   Transcript: ENSDORT00000001971
Sequence length 1910
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4870:4012:116192:-1 gene:ENSDORG00000001958 transcript:ENSDORT00000001971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LALHPERVLVATGQVGKEPYICVWDSYTVQTISVLKDVHTHGIACLAFDLDGQRLVSVGL
DSKNTVCVWDWKRGKMLSMAPGHTDRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGIFTMNAC
EEGFATGGRDGCIRLWDLTFKPITVIDLRETEQGYKGLSVRSVCWRGDHILVGTQDSEIF
EIVVHERNKPFLIMQGHCEGELWALAIHPTKPLAVTGSDDRSVRIWSLVDHALIARCNME
EPIRCAAINVDGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDGTYLAVG
CNDNSVDIYGVAQRYKKIGECVGSLSFITHLDWSSDSRHLQTNDGHGKRHFYRMPGGKEV
TSKEEIKGVHWASWTCVSGIEVNGIWPKYSDINDINSVDGNYIGQVLVTADDFGIVKLFR
YPCYKKGAKFRKYIGHSAHVTNVRWSHDYQWVISIGGADHSVFQWKFIPERKLKDALHIA
PQETLAESNSDESDSDLSDVPELDSEIEQETQLTYHRQVYKEDLPQLKEQYKEKQNSVTS
KRRDQAPGNSIRLHFIHGYRGYDCRSNLFYTQIGEIVYHVAAVGVIYNRQQNTQRFYLGH
DDDILCLAIHPLKDYVATGVGKDPSVHIWDTETIKPLSILKGFHQYGVCAVDFSXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXGSKDKIFVVKMNPHVPDKLITVGIKHMKFWRRAG
GGLIGRKGYIGTLGKSETMMCAVYGWTEEMAFSGTSTGDVCIWRDVFLVKTVKAHDGPVF
SMHALEKGFVTGGKDGIVALWDDSFERCLKTYAIKRAALAPGSKGLLLEDNPSIRAISLG
HGHILVGTKNGEILEMDKSGPITLLVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXLKKGGRCCCFSPDGKALAVGLNDGSFLMANADTLEDLVSFHHRKDIISD
IRFSPGSGKYLAVASHDTFIDIYNVMNSKRVGICKGATSYITHIDWDIRGKLLQVNTGAK
EQLFFEAPRGKKQTIPSVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXGKFGKFKKYVAHSTHVTNVRWTYDDSMLVTLGGADMSLMVWT
NEVESYRERRPCDSEESDIDSEEDGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLVLDLVFGYRGRDCRNN
VHYLNDGDDIIYHTASVGILHNVATGTQSFYQEHNDDILCLTINQHPKFINIVATGQVVL
SYCAITTAPSIHVWDAMNKQTLSILRCYHSKGVCSVSFSATGKLLLSVGLDPEHTITIWR
WQEGAKIASKAGHSQRIFVAEFRPDSDTQFVSVGIKHVKFWTLAGRALLSKKGLLSTLQD
ARMQTMLAVAFGANNLTFTGTISGDVCVWKDHMLCRVVAKAHNGPVFAMYTTLRDGLIVT
GGKERPSKEGGAVKLWDQELRRCRAFRLETGQATDCVRSVCRGKGKILVGTRNAEIIEVG
EKNAACSTLVNGHVDGPVWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAAR
TVCYSPEGDMVAIGMKNGEFIILLVTSLKIWGKKRDRRCTIHDIRFSPDSQYLAVGSSDN
SVDFYDLTLGPTLNRVGYCKDIPSFVIQMDFSADSRFLQVSSGCYKRHVYEVPSGKHLLD
HAAIDRITWATWTSILGDEVMGIWSRHAEKADVNCACVSHSGISLVTGDDFGMVKLFDFP
CPEKFAKHKRFLGHSSHVTNIRFTSGDRHVVSAGGDDCSLFVWKCIHMPH
Download sequence
Identical sequences ENSDORP00000001851 ENSDORP00000001851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]