SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001856 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001856
Domain Number 1 Region: 19-237
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-66
Family Phosphate binding protein-like 0.00000955
Further Details:      
 
Domain Number 2 Region: 239-301,331-352
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 1.44e-19
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001856   Gene: ENSDORG00000001976   Transcript: ENSDORT00000001976
Sequence length 361
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5610:63672:72939:1 gene:ENSDORG00000001976 transcript:ENSDORT00000001976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGNGGVAVTAEENNLKMRVIRVGTRKSQLARIQTDTVVAMLKTFYPGVQFEIIAMSTTG
DKILDTALSKXXXXXXXXXXXXXXXXXXXVDLVVHSLKDLPTVLPPGFTIGAICKRENPC
DAVVFHPKFVGKTLETLPERSVVGTSSLRRAAQLQRKFPHLEFKSIRGNLNTRLRKLDEQ
QEFSAIILAVAGLYRMGWQNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVSVLHD
PETLLRCIAERAFLRHLEGGCSVPVAVHTVMKDGQLYLTGGVWSLDGSDSMQETMQTTIH
APAQHEDGPEDDPQMVGITARNIPRRAQLAAESLGISLASLLLNKGAKNILDVARQLNDA
R
Download sequence
Identical sequences ENSDORP00000001856 ENSDORP00000001856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]