SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001966 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001966
Domain Number 1 Region: 390-544
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.5e-32
Family Phosphate binding protein-like 0.00000269
Further Details:      
 
Domain Number 2 Region: 218-343
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000133
Family L-arabinose binding protein-like 0.03
Further Details:      
 
Domain Number 3 Region: 20-129
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000000863
Family L-arabinose binding protein-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001966   Gene: ENSDORG00000002099   Transcript: ENSDORT00000002100
Sequence length 906
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4186:860:133523:1 gene:ENSDORG00000002099 transcript:ENSDORT00000002100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYIVAVFCTGFLGTVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLFPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FILQLRPELQDALISIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIKLEKNGMGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEELEEGRDQTPSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGNKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGTSGSGSGENGRVVSHDFPKSMQSIPCMSHTSGMP
LGATGL
Download sequence
Identical sequences ENSDORP00000001966 ENSDORP00000001966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]