SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002026 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002026
Domain Number 1 Region: 172-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000681
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000002026
Domain Number - Region: 141-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000876
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002026   Gene: ENSDORG00000002161   Transcript: ENSDORT00000002161
Sequence length 543
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4207:45123:68433:1 gene:ENSDORG00000002161 transcript:ENSDORT00000002161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQILLLTFLVTSVSPMALDPCSAYVSLNDPWRNTEHQLDESQGSPACDSHVDGEWYRFT
GMAGDAMPTFCVPENHCGTHAPVWLNGSHPVEGDGIVQRQACASFKGNCCLWNTTVEVKA
CSGGYYVYRLAKPSVCFHVYCGHFYDVCEEDCQDSCSDTDECTCPPGSVIGHDGQTCFDE
NECEQNNGGCSEICVNLKGSHRCQCGVGRVLRSDGRTCEXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXPVLCKSSTIEVSVPRELVGGLELFLTNTSCRGVSNGTHV
NIFFSLKTCGTVVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCVSDDSVKQYSSRDHLVKHFQVPVFKF
VGKDHKEVFLHCQVLVCRMLDEQSRCAQGCHRRLRREAGPAEDWARLQRQTLSGGPISID
WED
Download sequence
Identical sequences ENSDORP00000002026 ENSDORP00000002026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]