SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002229 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002229
Domain Number 1 Region: 222-387,419-481
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-38
Family Voltage-gated potassium channels 0.0035
Further Details:      
 
Domain Number 2 Region: 40-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.84e-25
Family Flavin-binding PAS domain 0.00014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000002229
Domain Number - Region: 484-527
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0189
Family cAMP-binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002229   Gene: ENSDORG00000002370   Transcript: ENSDORT00000002371
Sequence length 1020
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_886:11656:31367:-1 gene:ENSDORG00000002370 transcript:ENSDORT00000002371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQGPRGFPIVYCSDGFCELTGYGRTEV
MQKTCSCRFLYGPETSEPALQRLHKALEGHQEHRAEICFYRKDGSAFWCLLDMMPIKNEM
GEVVLFLFSFKDITQSTGPGLGPSGVHGDSNHENSLGRRGATSKLRSTRRQSRTVLHRLS
GHFSRRNQRNMKTNNNVFEPKPSVPEYKVASVGGSRCLLLHYSVPKAIWDGLILLATFYV
AVTVPYNVCFSGDDDTPIASRHTLVSDIAVEMLFILDIILNFRTTYVSQSGQVVSAPRSI
GLHYLATWFFVDLIAALPFDLLYIFNITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAV
VLTLLMSVFALLAHWMACIWYVIGRREMETNDPLLWDIGWLHELGKRLEVPYVNGSAGGP
SRRSAYIAALYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQR
MYSRRSLYHSRMKDLKDFIRVHRLPRPLKQRMLEYFQTTWAVNSGIDANEXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLSRFSRSPRLSQPRSDSLGSSSDK
TLPSITEAESGTEPEGSSRPRRPLLLPNLSPARPRGSLVSLLGQELPPFSALVSSPSLSP
SPSPTPAGQGQSSSTHRPPRSSAAWKPPQLLIPPLGTVGPPDLSPRXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXTRHSQELATEAAEEVKEKVCRLNQEISRLNQEVSQLSQ
ELRHVMGLLQSRLCSPGPGHPTVLAWPSGPPCPQQGPQFISACVSRPPPGPQDTTLAEVH
CSASVGTVEMGATPLDLRSSMLSPYPSEPDPLGPSPVSEASPPTPSLTRHSFQSKSDTFH
Download sequence
Identical sequences ENSDORP00000002229 ENSDORP00000002229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]