SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002258 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002258
Domain Number 1 Region: 4-455
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 2.35e-116
Family 2-methylcitrate dehydratase PrpD 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002258   Gene: ENSDORG00000002400   Transcript: ENSDORT00000002403
Sequence length 483
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1274:1473:8514:1 gene:ENSDORG00000002400 transcript:ENSDORT00000002403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLKSVTESFASLIHGLTAGHLTDSVIQKSKRMILDTLGVGLLGTSTGVFHKVSQYSKIY
SSNTSSTVWGQSDFRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLTALTEALP
QSPRFSGLDLLLAFNVGVEVQGRLMHFSKEANDIPRRFHPPSVVGTLGSAAAASKFLGLS
LTKCQEALAIAASYAGAPMANAATETKPLHMGNAARHGIEATLLAMLGLQGNQRVLDLER
GFGAFYANYSPKVLPSLDSHTWLLDQQDVAFKSFPAHLATHWVAEAAGAVRKRLGPPGGI
LFPADHIKKIVLRIPDVQYVNRPFPDSEHEARHSFQYVACAMLLDGCVTVPSFHKPQIHR
PQVRELLGKVELEHPPDNQPNFNSLYCEISVTLQDGSTFTERSDTFYGHWRKPLSQEDLR
GKFTVNASRTLSWDTVESLIKVVEKLEDLEDCSVLTTLLKGSSPPEEASKYPEDNPSIAN
LSQ
Download sequence
Identical sequences ENSDORP00000002258 ENSDORP00000002258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]