SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002273 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002273
Domain Number 1 Region: 2295-2382,2435-2618,2653-2708
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.25e-72
Family DNA polymerase I 0.0000078
Further Details:      
 
Domain Number 2 Region: 232-400,433-488,541-629
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.01e-39
Family Tandem AAA-ATPase domain 0.00015
Further Details:      
 
Domain Number 3 Region: 793-892
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.57e-18
Family Achaeal helicase C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002273   Gene: ENSDORG00000002416   Transcript: ENSDORT00000002419
Sequence length 2712
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_308:659:61741:-1 gene:ENSDORG00000002416 transcript:ENSDORT00000002419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIKARGALASQKAEHKPISKVLAQEDPLGTFTPPFLQLSRRVIPDPQSQLFPRAPQLKQK
LETEVVPPYHHRIHLGERKGKLGSTRNFESWREDGRSTCHRAGFLRLGELLGLQCRVLNH
KERLAMDPPRRSGKRRRSESSPDSRSASGGDSSASPQVLSERGPGPPRALGRVCLELRPG
AAGGVCKQTVPDDQIDKLLLANWGLPKEVLEKYHSFGVKKMFEWQAECLLLGQVLEGKNL
VYSAPTSAGKTLVAELLILKRVLEMRKKALFILPFVSVAKEKKYYLQSLFQEVGIKVDGY
MGSSSPAGHFSSLDIAVCTIERANGLINRLIEENKMDLLGMVVVDELHMLGDSHRGYLLE
LLLTKICYITQKSASCQPESPKSLSKAVQIVGMSATLPNLELVASWLNAELYHTDFRPVP
LLELVKIGNSIYDSSMKLVREFQPMLQVKGDEDHIVSLCYETVRDNHSVLLFCPSKKWCE
KLADIIAREFYNLHKQAEGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXLTFEERDIIEGAFRQGLIRVLAATSTLSSGVNLPARRVIIRTPIFSGRP
LDILTYKQMVGRAGRKGVDTLGESILVCKNSEKSKGIALLQGSLKPVRSCLQRREGDEIT
ASMVRAILEIIVGGVASTSRDMQTYASCTFLAASMKEGKQGIQRNEDSVHLGAIEACVLW
LLENEFIQIAGASDGSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXVTPMFEDWTTIDWYRFFCLWEKLPASMKRVAELVGVEEGFLARSVKGKVVARTER
QHRQMAIHKRFFTSLVLLDLINEVSLKEINQKYGCNRGQIQSLQQSAAVYAXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXARKAVDEEEEAAEERRNMQTIWVTGRKGLTANEAAVLIVEEAKMILQ
QDLVELGVQWDPYSPLSTSTHSLINSDSEVKTHMFVPQTVSSHQREKYKKKSNTRFSDSH
NIYSSNTVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXRSQSKNVTCQASVASNCRRIAVETEKINDVLIQDDLKKQNIFVKSHDTP
PVGQSLEKQCDKQTNTCIKQKSVIETQMLCQVLNSNIQKESNAATMKRESIKPNNEESEQ
NHFQALGDKIRKTEVPSRILQSTEPFGKTEDQHENFLNSTKIQEKKDTYSTNKTINNPAS
DLSLVLCDVEDSFYLDTQSEKIMQQMVIENAKQGIKDTSLAVGIVQRSLDRQNSFQNECH
VTSSSDQHFPRTTNMDHLDLKTIDTEYGNDRLILKSFTLRSPVLLEENGLCFKGNEYSVT
DSQLNSFLQGYQTQETVKPVKLTAPQKRSPTGGETECLPGPETSLNMSDSLLFDSFSEDL
LAEEPPPDIEAKGPHPSEIISNHFSDSQHLQGDPVQKTNMTEPLIAQQQLTSFNDESIIF
SEMDSVQIVEALDNVAKSVQENLNTSISLRALELSDSAIFRYPQDEVRRNQDETAQTSRL
TEARQNNSFIWSGASFDLSPGLQRILDKVYSPVENEKPKLTTVNLLCLKEKNTELNERQE
VVSNLETYQVQGISFFPNNEVKRKVDKSLENSASHSETSSPLACKESSLGDDNGLIPPTP
SPASASKVTFPEILGTSVKLQNTSSVLQPGESFIFGSPSDIKNHDLSLESINSLQDDSPL
RDKSFSLQLSLDELQLTPASCNSETLAIIDVASNQTLFQTFIKEWQCKKRFSISLACEKI
KSLTSSKTATIGSRFRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXISASLAPPSLDPSLTVRDRMQHLQSCLQKQSNKERSVIIYDFIKSYKILLLSCG
ISLEQSYEDPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLFLELKLPPNGEMKIQGNKKTLG
STRRGNDTGRKSRLGRRFSTSKDVLNKLKELHPLPGLILEWRRISSAITKVVFPLQREKR
LNPFLGMERIYPVSQSHTATGRISFTEPNIQNVPRDFEIRMPTLLDESSPSQVLDKGQPL
MVRGHSKKGCGLYPEHRAPVDEQALAREVPFSVSMRHAFVPFPGGLILAADYSQLELRIL
AHLSQDHRLIQVLNTGADVFRSIAAEWKMIKPESVGDDLRQQAKQXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXISHFMKETVKNCKRDGFVQTILGRRRYLPGIKDNNPY
HKAHAERQAINTTVQGSAADIVKVATVNIQKKLETFHSIFKSHGHREGMLQRDRAVGLLL
KGRLPGIFCPIRGGFFILQLHDELLYEVAEEDVFKVAQIVKNEMESAIKLSVKLKVRVKL
GASWGDLKDFDV
Download sequence
Identical sequences ENSDORP00000002273 ENSDORP00000002273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]