SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002397 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002397
Domain Number 1 Region: 428-600
Classification Level Classification E-value
Superfamily TRAF domain-like 1.36e-37
Family MATH domain 0.0011
Further Details:      
 
Domain Number 2 Region: 185-257
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000178
Family Astacin 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000002397
Domain Number - Region: 71-123
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00018
Family Astacin 0.016
Further Details:      
 
Domain Number - Region: 380-429
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000222
Family MAM domain 0.034
Further Details:      
 
Domain Number - Region: 668-692
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00347
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 266-303
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0443
Family MAM domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002397   Gene: ENSDORG00000002552   Transcript: ENSDORT00000002552
Sequence length 692
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5378:210898:232484:1 gene:ENSDORG00000002552 transcript:ENSDORT00000002552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWTRSIAFLSFSLLFIHIGAVSIKRLAKGNARDTDLEQKDISEINLAAGLDLFQGDILL
PKSRNGLRDPTYRWKFPIPYILADNLELNAKAAILHAFEMFHLKSCVEFKPYAGESSYII
FQQFSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXYEHNFNYDDTFITDLNTPYDYESLMHYAPFSFNKNESVPTITAKIPEFDAILGQR
LDFSAIDLERLNRMYNCTSTHTLLDHCAFEKTNICGMIQGTRDDADWAHRDSDQPGQTDH
TLGGRCTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXDSDHRWKIAHVTLKEEKKFRYLFQGTRGDPQNSAGGIYLD
DVTLTETPCPTGVWTIQNISQFLQSAAQGDRLHSPRFYNSEGYAFGVTVYPRGRVTSVDP
EHVGLAFHLCSGENDAILEWPVMNRQAIMTILEQEADVRHRMSLSLMFTTSESHTSPAIN
GSVIWDRPSKVGTYDQDCDCFRSLDWGWGQAISHQMLRKRSFLKNDDLVIFVDFEDITHL
RRTEVPTTGRRHSPQGLILHDRESRASGEGSGRAAFNEALPGDLAAGRQKRSVENTGPLE
DHNWPQYFRDPCDPNPCQNKGLCVNVKGTASC
Download sequence
Identical sequences ENSDORP00000002397 ENSDORP00000002397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]