SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002409 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002409
Domain Number 1 Region: 219-319
Classification Level Classification E-value
Superfamily ApaG-like 3.4e-31
Family ApaG-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002409   Gene: ENSDORG00000002565   Transcript: ENSDORT00000002565
Sequence length 332
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1619:32911:41321:-1 gene:ENSDORG00000002565 transcript:ENSDORT00000002565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAACAARRALAVGSRWWSRSLTATRGRPLYAAGGAGAFQPVTSATTRRHLSSRNRAEGKV
LETVGVFEVPKQNGKYETAENPAGHGSKEVRGKTHTYYQVLIDARDCPHISQRSQTEAVT
FLANHDDSRALYAIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAQNSHVYWWRYCIRLENLDSDV
VQLRERHWRIFSLSGTLETVRGRGVVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRF
ERPDGSHFDVRIPPFSLESNKDEKTPPSGLHW
Download sequence
Identical sequences ENSDORP00000002409 ENSDORP00000002409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]