SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002507 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002507
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 5.05e-71
Family Alanine racemase-like, N-terminal domain 0.00000000101
Further Details:      
 
Domain Number 2 Region: 262-419
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.35e-49
Family Eukaryotic ODC-like 0.000000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002507   Gene: ENSDORG00000002669   Transcript: ENSDORT00000002669
Sequence length 461
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_50290:784:5914:-1 gene:ENSDORG00000002669 transcript:ENSDORT00000002669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHFNKEEVDCHVLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWFKALP
RVTPFYAVKCNDSRAILSTLAAVGTGFDCASKTEIQLVQSLGVPSNRIIYANPCKQVSQI
KYAAGSGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKTSRLL
LERAKELNIDVIGVSFHVGSGCTDAETFVQAVSDARCVFDMGADFGFSMHLLDIGGGFPG
SEDVKLKFEEITSVINPALDKYFPSDSGVKIIAEPGRYYVASAFTLAVNIIAKKIVWKEQ
SGSDDEDELNEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSASIWGPTC
DGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIHYVMSRPMWQVMQQV
QKHGFPPGVEEQDVSTLPLSCAQESGLERRPAACTSASINV
Download sequence
Identical sequences A0A1S3EZB3
XP_012869245.1.60039 ENSDORP00000002507 ENSDORP00000002507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]