SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002537 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002537
Domain Number 1 Region: 21-242
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.36e-49
Family Ankyrin repeat 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002537   Gene: ENSDORG00000002700   Transcript: ENSDORT00000002700
Sequence length 257
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2552:42023:46081:1 gene:ENSDORG00000002700 transcript:ENSDORT00000002700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKLLSLWRMKDESLSQSYNFQHKHSKKLHKAASVGDLEKLKEYLKYKKHDVDKRDKGHX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXNGYESIVSLLIEKQCKINVLDGEKRSPLIKAI
QYQKEKCVTILLDHGADPNLVDFHYNTALHYAVCGQSVSIVRKLLEHKANLEAKNKDGYT
PLLLAVVKNNAKMVKFLLKKGADVNASDNNQRTALMIALSFEPTNLVSLLLQQGVDLSCQ
DIMVSRLQNMLLVMVLL
Download sequence
Identical sequences ENSDORP00000002537 ENSDORP00000002537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]