SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002682 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002682
Domain Number 1 Region: 211-724
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.92e-50
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 
Domain Number 2 Region: 677-829
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000479
Family Quinoprotein alcohol dehydrogenase-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002682   Gene: ENSDORG00000002855   Transcript: ENSDORT00000002856
Sequence length 830
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_458:22642:120948:1 gene:ENSDORG00000002855 transcript:ENSDORT00000002856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGFSSYSSLYDTSSLLQFCNDDSASAASSMEVSDRIASLEQRVQMQEDDIQLLKSALA
DVVRRLNITEEQQAVLNRKGPTKARPLVQTLPLRTTVNNGTVLPKKPSGSLPSPSGSRKE
ITIPATKRLNRTVSLLKAGRQNRSIPCSIKRTSSSERVSPGGRRENSGDSKGSRNRTGST
SSSSSGKKNSESKPKEPVFSAEEGYVKMFLRGRPVTMYMPKDHVDSYNLEAKAELPTKRL
KLEWVYGYRGRDCRNNLYLLPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVHP
DRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGSS
LCAVDDSNEHVLSVWDWQREERLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLE
GNSLIKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHDG
GIFALCMLRDGTLVSGGGKDRKLISWNGNYQKLHKTEIPEQFGPIRTVAEKGDILIGTRN
FVLQGLSGDFAPITQGHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIED
PAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGS
HDNCIYIYGVGDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACK
QVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDFGKVHL
FSYPCSQFRAPSHVYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI
Download sequence
Identical sequences ENSDORP00000002682 ENSDORP00000002682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]