SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002700 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002700
Domain Number 1 Region: 152-233
Classification Level Classification E-value
Superfamily S13-like H2TH domain 6.93e-21
Family Middle domain of MutM-like DNA repair proteins 0.016
Further Details:      
 
Domain Number 2 Region: 59-149
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.0000000327
Family N-terminal domain of MutM-like DNA repair proteins 0.0096
Further Details:      
 
Domain Number 3 Region: 315-341
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000798
Family Ran binding protein zinc finger-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002700   Gene: ENSDORG00000002876   Transcript: ENSDORT00000002876
Sequence length 593
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1652:40554:81675:1 gene:ENSDORG00000002876 transcript:ENSDORT00000002876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEGPGCTANGEEIRARVVPGQAVTGVRGSALQSLQLPRADSGADASFQAAALNNNDSSW
NFLRLFHGYVYSGVETLGKELFMYFGPKALRIHFGMKGSIMINPLNYKTKNRVSPVLEVQ
LTKDLICFFDSSVELRNSVESQQRIRMMEELDICSPKFYFSRAKNEVKKQKGRMLCDVLL
DQKVLPGVGNIIKNEALFDSGLHPAVKVCQLTDEQIQHVVKMTRDFSILFYRXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLPTRNTIISWT
ANTDHYVDSVAQKFEEQWTCAVCTLINKPSVQACEACLTPRPVDSVLKSKENSTACTNLV
KYPCNNFGKTHTEVKINRKTVFGTTTLVLTDFSNKSNTPERKKSQNQLLDKEFHNSLPTD
VCFSGTEHPSDKRIDFITQLPNKSXLFSPAHKKLKTTHDSSPDHFKNCNLGASNRVLQTN
MAGNPCTLNASSPRCSQHNRLCVLRVVRKDGENKGRQFYACSLPGKDQCGFFKWADLSFP
LCKHGKRCIMRTVLKIGPNNGKNFFVCPLGKEKQCNFFQWAENGPGIKIIPGC
Download sequence
Identical sequences ENSDORP00000002700 ENSDORP00000002700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]