SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002948 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002948
Domain Number 1 Region: 279-427
Classification Level Classification E-value
Superfamily Kelch motif 3.4e-31
Family Kelch motif 0.00028
Further Details:      
 
Domain Number 2 Region: 96-178
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000345
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002948   Gene: ENSDORG00000003151   Transcript: ENSDORT00000003151
Sequence length 431
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_22668:15188:16596:-1 gene:ENSDORG00000003151 transcript:ENSDORT00000003151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSAAPGGLHPADDPAGPRGSRDAASRAQTPCGLGASLCFAAADPRARAVXXXXXXXXX
XXXXXXXVKETPSPEEELEPAPPAAPGLALALGEPDLVLEVAGRRLRAHKAVLAARSDYF
RARASRDVLRVRGVGPAALRLLLADAYGGRMAGVRPDNVAEVVAGARRLQLPGAAQRATE
AVAPQLSPDNCAAVLGAAKRRRLAELRDAAYRFMSDHYLEVLRRPAVFGRLSGAERELLL
RRRLRAGRACLLAAALAPAAGARATRGPPGAAGARGEAAALYRFCAAAGAWRALAPLPEG
APARGCGLAVLHNYLFVAGGVAPAGPSDRVFCYNPATGRWSAARPLRQARSQLRMLALDG
HLYTVGGECKLGVERYNPSADRWAAVAPLPRGAFNVNPAAADCNGELYVSGGSLFGRLLK
YDPRRNKQDCP
Download sequence
Identical sequences ENSDORP00000002948 ENSDORP00000002948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]