SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002958 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002958
Domain Number 1 Region: 2082-2204
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.98e-18
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 2004-2075
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.71e-17
Family TB module/8-cys domain 0.0000967
Further Details:      
 
Domain Number 3 Region: 1480-1553
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.89e-16
Family TB module/8-cys domain 0.0000582
Further Details:      
 
Domain Number 4 Region: 1158-1298
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.85e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 5 Region: 1719-1849
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000235
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 1036-1163
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000361
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 7 Region: 1843-1967
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000942
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 295-365
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000157
Family TB module/8-cys domain 0.0016
Further Details:      
 
Domain Number 9 Region: 1640-1704
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000196
Family TB module/8-cys domain 0.0007
Further Details:      
 
Domain Number 10 Region: 191-276
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000255
Family TB module/8-cys domain 0.0021
Further Details:      
 
Domain Number 11 Region: 2293-2362
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000314
Family TB module/8-cys domain 0.001
Further Details:      
 
Domain Number 12 Region: 1363-1490
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000018
Family Growth factor receptor domain 0.009
Further Details:      
 
Domain Number 13 Region: 1559-1614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000529
Family EGF-type module 0.00096
Further Details:      
 
Domain Number 14 Region: 2446-2556
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000926
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 15 Region: 2401-2455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000218
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 16 Region: 1961-2009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000659
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 17 Region: 2361-2412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000161
Family EGF-type module 0.012
Further Details:      
 
Domain Number 18 Region: 1285-1340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000152
Family EGF-type module 0.02
Further Details:      
 
Domain Number 19 Region: 1331-1361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000524
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000002958
Domain Number - Region: 2601-2638
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000348
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002958   Gene: ENSDORG00000003159   Transcript: ENSDORT00000003161
Sequence length 2793
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3475:1505:57812:-1 gene:ENSDORG00000003159 transcript:ENSDORT00000003161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIQEGPCLVRRVSRDFPMAWGPPSRLLLACVVLLCMTDGQGRWHGAVEPVGPGRVRRRGG
PGFLLQGPNICGSHFHAYCCPGWRTLPGGNRCIVPICRHPCGQGFCSQPNLCTCVDGTLA
PSCGVSPELGCSISCMNGGSCRGASCLCQRGYRGTVCGQPICNPSCQNGGRCIGPNLCAC
VYGFLGSHCETDYRTGPCFSQVGSKGCQHQPRGLTFTKALCCATVGHAWGLPCEPCPPQP
HPCRRGFIPSIRTGACQDVDECQAIPGLCQGGSCTNTVGSFKCRCPVGHRLSASGVTCED
RRLGTCFSVLISGHCAAALGGRYPRRQCCCDLGRCWAASLPLELCPSPGSDEFRRLCNLG
QARLPSYPSLFPGLPGFRSSGTEPARPSPRGSSGPGVPSLGPGNPNIXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXIDECLISPDLCGQGVCVNTPGSFECECFPGYTSGFMLMKNCMDVD
ECVRDPLLCRGGSCTNTDGSFECRCPPGHKLTAQGTACEDIDECALRDSLCLHGQCVNLI
GTFHCVCHSGFQVTPERQGCQDIDECRVGNGGCEAHCVNTEGSFQCSCGQGYVLRPDGRA
CADVDECEENPAVCGQGRCTNEPGGHRCLCYEGFTAAPDAKTCVDVNECDLNPDICLHGN
CENTKGSFVCHCQLGYIVRKGATSCSDLDECEPGQDSCDSHASCLNTPGSFSCRCRPGWV
GDGFKCHDMDECTTPEHHCSPRADCLNVPGSYRCACRPGFRDECAENMDLCENGHCLNVP
GGYYCECEMGFTPTGDHGACQDVDECALETLCVPGSCENLPGMFCCLCEDGYELDHGGSH
CTDINECADPVNCINGQCINTPGSYLCNCPQDFELNPSGVGCVDTRAGNCFLEMHSRGDG
GVSCSAEVGVGVTRASCCCSLGRAWGNPCELCPMGNTSEYRTLCPGGEGFRPNPNTVILE
DIDECQELSGLCQGGNCANTFGSFQCECPHGYQLSGDTRICEDIDECATQLGICGPGTCY
NTLGNYTCICPAEYLQVNGGNNCMDMRKSMCFRYYNGTCRHELAFNITQKMCCCSYNIGQ
AWNRPCEACPTPASSDYQVLCGSQVPGFITDMHTGRPRDIDECREIPAICTHGVCINQAG
NFHCECPMGFQYHSDLLACEDVDECGTTESPCGRKESCVNIPGSYRCECAQGFTLSPRGV
CVGWNECQEIMNVCGHGDCVDMEGSYVFLCHHGFRASADQTLCMDLDECDWWPYGNGTCK
NTIGSYNCLCFPGFAASHNGDCVDTDECTILVGQVCQFGQCLNIAGSFLCICQDGFELTA
DGRNCVDTNECVTLSESCLPGVCQNLEGSFRCSCPLGFQVQREHCVDIDECLEEPNICPF
GTCINSPGSFTCLCPPGFVPSENGHRCFDTRQSFCFTRFEAGKCLVPKAFNNTKTRCCCS
KRPGEGWGDPCELCPQEGSAAFQELCPFGHGAVPGPDDSREDVNECAENPGICANGLCVN
TDGSFRCECSFGYSLDFTGISCVDTDECSLGHPCGEGTCTNVIGGFECACADGFEPGPMT
ICEDIDECSLNPLLCAFRCLNIEGSYLCTCPAGYALREDRATCRXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXTRQGLCFTEVLQAVCQVRSGSDETVPWAVCCCGGGRGWGPQCEPCPLR
GTSTFWKLCPHGSGYTTEGRDVDECRVLTHLCFHGECINTVGSFHCHCQAGYTPDAAATA
CVDVDECSQDPKPCPFLCKNTEGSFLCACPRGYRLEEDGRTCRDLDECSSRHHNCQFICV
NTIGTFSCRCPPGFTQRHQACFDNDECSAQPGPCGTQGRCHNSPGNFHCECYQGFTLDSS
GRSCEDIDECDGPHSCHDGCQNELGGYCCNCPHSQWAQYVXXXXXXXXXXXXXXXXHNTH
GGFHCVCSSCNFNQALGGCHDVKECVGQGSPCSFCANTAGSFLCGCPQGYFRAGQGHCVS
SLGFGHEPQESSYENKALSSETCYECSINSLSPQDRPQRSPRHHQVSLATFDTEVHLTLS
LNLSRLGQAQHILGLQPALEGLAGRVRYIISHGNQQGFFRMQHQGILSYLQLGRRRPQPG
MYQLEVVSVPGPQGVWPGPVGQALRLQVRLQLL
Download sequence
Identical sequences ENSDORP00000002958 ENSDORP00000002958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]