SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003331 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003331
Domain Number 1 Region: 125-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000168
Family EGF-type module 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003331   Gene: ENSDORG00000003561   Transcript: ENSDORT00000003561
Sequence length 232
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4602:43712:139060:-1 gene:ENSDORG00000003561 transcript:ENSDORT00000003561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPFYFRPIGSNQGVPAARSVLPPPPPARPAPGRPCPASAFFPRAAAPLSQSGTAGRAGGW
SARRPPARPPPARKMVTSAGQLALFALGIVLAVCQALENSTSPLSXXXXXXXXXXXXXXX
XXXXXXHFCLHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVV
SIVALAVLIITCVLIHCCQVRKHCDWCRALICRHEKPSALLKGRTACCHSET
Download sequence
Identical sequences ENSDORP00000003331 ENSDORP00000003331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]