SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003336 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003336
Domain Number 1 Region: 5-442
Classification Level Classification E-value
Superfamily ALDH-like 4.32e-125
Family ALDH-like 0.000000000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003336   Gene: ENSDORG00000003566   Transcript: ENSDORT00000003566
Sequence length 465
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6292:17842:27982:1 gene:ENSDORG00000003566 transcript:ENSDORT00000003566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLEDTLRRLREAFCAGRTRPAEFRAAQLRGLGRFLQDHKQQLQQALAQDLHKSDFESL
VSEIVISQGEVDLALRNLRAWMKDERVSRNLATQLDSAFIRKEPFGLVLIVAPWNYPVNL
TLVPLVGALAAGNCVVLKPSELSRSTEKVLAEELPRYLDPSCFAVVLGGPSETEQLLEHR
FDYIFFTGSPRVGRIVMAAAAKHLTPITLELGGKNPCYVDDDCDPQTVANRVAWFRYFNS
GQTCVAPDYVLCSPETRERLLPALQSAITRFYGDDPKSSPNLGRIINQKHFLRLQGLLRC
GRVAIGGQSDESDRYIAPTVLVDVQDTEPVMQEEIFGPILPLVTVRSLDEAIDFINQREK
PLALYAFSNSSQVVRQVLARTSSGGFCGNDGFMHMTLASLPFGGVGHSGMGRYHGKFSFD
TFSHQRACLLRSPGLEKVNHIRYPPYKLRLLLLAMEERRCSCTLL
Download sequence
Identical sequences ENSDORP00000003336 ENSDORP00000003336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]