SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003431 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003431
Domain Number 1 Region: 331-628
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 8.27e-43
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.006
Further Details:      
 
Domain Number 2 Region: 105-241
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.44e-38
Family Ferredoxin domains from multidomain proteins 0.00022
Further Details:      
 
Domain Number 3 Region: 32-104
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.56e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003431   Gene: ENSDORG00000003668   Transcript: ENSDORT00000003668
Sequence length 628
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_169:1631:21444:-1 gene:ENSDORG00000003668 transcript:ENSDORT00000003668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRIPVRRALVGLSNSPKGYVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI
PRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKTKKAREGVMEFL
LANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCT
RCIRFASEIAGVDDLGTTGRGNEMQVGTYVEKMFMSELSGNVIDICPVGALTSKPYAFTA
RPWETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQSFQGKEVAAIAGGLVDAEALVALKDILNR
VDSDILCTEEIFPTAGAGTDLRSNYLLNTTIAGVEEADVILLVGTNPRFEAPLFNARIRK
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLKEAKKPMVVLGSSA
LQRNDGAAIFATVSNIAQKIRVTSGVTADWKVMNILHRIASQVAALDLGYKPGVEAIRKH
PPKMLFLLGADGGCITRQDLPKDCFIVYQGHHGDVGAPIADVIFPGAAYTEKSATYVNTE
GRAQQTKVAVTPPGLAREDWKILRALSE
Download sequence
Identical sequences ENSDORP00000003431 ENSDORP00000003431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]