SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003457 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003457
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 4.59e-32
Family Phosphoglycerate kinase 0.00000206
Further Details:      
 
Domain Number 2 Region: 176-212
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 0.000000000236
Family Phosphoglycerate kinase 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003457   Gene: ENSDORG00000003697   Transcript: ENSDORT00000003696
Sequence length 213
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1243:151:5678:1 gene:ENSDORG00000003697 transcript:ENSDORT00000003696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDC
VGPEVEKACASPAAGSVILLENLRFHVEEEGKGKDASGNKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKVAD
KIQLINNMLDKVNEMIIGGGMAFTFLKVLNNME
Download sequence
Identical sequences ENSDORP00000003457 ENSDORP00000003457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]