SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003680 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003680
Domain Number 1 Region: 3-88
Classification Level Classification E-value
Superfamily POZ domain 3.09e-20
Family BTB/POZ domain 0.0055
Further Details:      
 
Domain Number 2 Region: 235-259,343-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000726
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003680   Gene: ENSDORG00000003941   Transcript: ENSDORT00000003939
Sequence length 434
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_64534:1168:5176:-1 gene:ENSDORG00000003941 transcript:ENSDORT00000003939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNTSHSLVLLQQLNMQREFGFLCDCTVAIGDVYFKAHRAVLAAFSNYFKMIFIHQTSEC
IKIQPTDIQDIFSYLLHIMYTGKGPKQIVDHSRLEEGIRFLHADYLSHIATEMNQVFSPE
TVQSSNLYGIQISTTHKTAVKQGLEVKDTPANNSGNRGSVQGDHPQLQLSLAIGLDDGTA
DQQRTHPSTQALEESQKPPVSIKQERCDPESLISQGRPSPSPEVTGPSFTENSIKVHICH
YCGERFESRNNLRQHLHTHVSGSLPFGVPASILESNDLGEVHPLNENSEALECHRLSSFI
VKENEHQPDHSNRGSAEPLQISQVSLISKDTEPVELNCNFSFSRKRKISCTICGHKFPRK
SQLLEHMYIHKGKSYRYNRCQRLGNALAQRFQPYWDNWSDVPLKSARLSQEHLDLPCALE
SELTQENVDTILVE
Download sequence
Identical sequences ENSDORP00000003680 ENSDORP00000003680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]