SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003726 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003726
Domain Number 1 Region: 240-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000481
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 2 Region: 369-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000181
Family Laminin-type module 0.0084
Further Details:      
 
Domain Number 3 Region: 421-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000254
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 4 Region: 306-359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family Laminin-type module 0.039
Further Details:      
 
Domain Number 5 Region: 471-506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000053
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 6 Region: 524-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000273
Family Laminin-type module 0.026
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003726
Domain Number - Region: 66-142
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00119
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.064
Further Details:      
 
Domain Number - Region: 824-887
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0204
Family Myosin rod fragments 0.0091
Further Details:      
 
Domain Number - Region: 961-1064
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0366
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003726   Gene: ENSDORG00000003991   Transcript: ENSDORT00000003992
Sequence length 1162
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_79:21573:57515:-1 gene:ENSDORG00000003991 transcript:ENSDORT00000003992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSLLCDQHACSRGACYPPVGDLLIGRTRFLRASSTCGLTKPETYCTRHGEWQMKCCKCD
SRLPHSYNSHRVENVASSSGPVRWWQSQNDVSPVSLQLDLDRRFQLQGIVMDFKGPMPAG
MLIERSSDFGKTWKVYQYLASDCASAFPRIRQGQPQSWQDARCQPIPQRPNGHQDGGKVQ
LNLMDLASGISASQGQKIQELGDITNLRVNFTKLAPVPQRGFHPPSAYFAVSQLRLQGSC
FCHGHADRCAPKPGASAHPSTAVKVHDVCVCQHNTAGPNCERCAPFYNNQPWRPAEGQDA
HECQRCDCNGHSETCHFDPAVFAASHGAQGGVCDNCRDHTEGRNCERCQLHYFRNRRPGA
PIQETCIPCECDPDGAVPGAPCDPKTGQCVCKEHVQGERCDLCKPGFTGLTYANPQGCHR
CDCSVLGARQDMPCDEESGRCLCLPNVVGPKCDQCAPSHWKLASGRGCEPCACDPRNSLS
SQCNQFTGQCHCREGFSGLKCNAAAMRRCPDRTHGDAITGCQACDCDFRGTEGPGCDKAS
GRCLCRPGVTGLRCDQCQRGYCDRYPVCVACHSCFQSYDSDLQEKARRLSSLRNATASLR
PGAGLEDPGLASRMLDARSKIQQIQAILSSASATEEEVAQVANAIFSIRRALQGLQLDLP
LEEEMATLPGDLESLDRSFNRFLIMYQGKREQFEKISSSDPSGAFRMLAAAYERSAQAAQ
QVSDSSHLLRQLRDSRREAEDPERQVGAGGGAGGPQLEALRLEMASLPDLTPTINKLCGG
SRQMACIPGACPGELCSQDNRTTCGPHCRGALPRAGGASRVAGQVAEQLRGFNLQLQQTR
QMIRAAEEAASQVQSDAQRLETQVSTSRSQMEEDVGRVRQLIQQVRDFLSXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
SRAHTVEGQVEEVVGNLRQGTVALQEAQDTMQGTSRSLRLIQERVAEVQQVLVPAEKLVM
SMTEQLGGFRTRMEGLRRQAQQQRAQAAQAQQLADGTNKWALSAQEXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMESELLTGSQDIVLHSARLTGL
EKRVEQIRDHINGRVLYYATCK
Download sequence
Identical sequences ENSDORP00000003726 ENSDORP00000003726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]