SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003845 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003845
Domain Number 1 Region: 97-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000817
Family VPS37 C-terminal domain-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003845   Gene: ENSDORG00000004117   Transcript: ENSDORT00000004117
Sequence length 355
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1688:18316:22656:-1 gene:ENSDORG00000004117 transcript:ENSDORT00000004117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLKDKTLQELEEMQNDQEVIERLALESPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFSSALQPGTLLDLLQIEGMKIEEESEAMAE
KFLEGEVPLETFLEAFSSMRMLSHLRRVRVEKLQDVVRRPRAPPEPARDAPPPRPPPPPP
RPAPPATPPVAEEQPPQPVAVPPYPLPYSPSPNLPTGPTAQGALRPAPFPVVAQPSSYGG
PLGPPYPSAQPGPRTSAGFSWSPQRSLPPRPGYPVAPTSASGPGYPLGGRASSPGYPQQS
PYLSPGAKPPYPTQPQLPGFPGPPQPSLPPQPPYPPGPAPPYGFPPPPGPAWPGY
Download sequence
Identical sequences ENSDORP00000003845 ENSDORP00000003845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]