SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003902 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003902
Domain Number 1 Region: 45-108
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000667
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 135-188,215-230,258-271
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000183
Family BphP N-terminal domain-like 0.074
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003902
Domain Number - Region: 323-350
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00354
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003902   Gene: ENSDORG00000004181   Transcript: ENSDORT00000004178
Sequence length 704
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6513:36125:90217:1 gene:ENSDORG00000004181 transcript:ENSDORT00000004178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDIPGSVTLPVASMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHSEI
ERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYKPS
FLTEQELKLILEAADGFLFVVAAETGRVIYVSDSVTPLNQPQSEWFGSTLYEQVHPDDVE
KLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNAPLDHLPL
NRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMAIPDEDADVGQGSKYCLVA
IGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFVDPRCISVIGYQPQXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADTIFSQERDP
RFAEMFAGISASEKKMLSSASAAGTQQIYSQGSPFPSGHSGKTFSSSVVHVPGVNDIQSS
SSTGQNISQISRQLNQSQVAWSGSRPPFPGQQIPSQSSKTQTSPFGIGTSHAYPADPSSY
SPLSSPATSSPSGSAYSSLANRTPGFAESGQSSGQFQGRPSEVWAQWQSQHHGQQSGEQH
SHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
Download sequence
Identical sequences ENSDORP00000003902 ENSDORP00000003902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]