SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003906 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003906
Domain Number 1 Region: 43-177
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.34e-23
Family Ankyrin repeat 0.0058
Further Details:      
 
Domain Number 2 Region: 171-247
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00000000000667
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003906   Gene: ENSDORG00000004183   Transcript: ENSDORT00000004182
Sequence length 268
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2095:133352:151274:-1 gene:ENSDORG00000004183 transcript:ENSDORT00000004182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFWELMDPEESLESDSTEKSLSSSQQLYDDESQEPEELSMENPLLQPALTGDVEGLQKIF
EDPENPHHENAMQFLLEEDIVGRNLLYAACMAGQSDVIRALAKYGVNLNEQTTRGYTLLH
CAAAWGRLETLKALVDLDVDIEALNFREEKARDVAARYNQTECVEFLDRADARLALRRYI
TKASLLLTDTEKWPGKLLKEDKNTIINVCRVKNEWLETHPEASVSELAEQRQQMEDIVTP
IIIKLSTPRPVKSAKSATNSDQKRSQNY
Download sequence
Identical sequences ENSDORP00000003906 ENSDORP00000003906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]